PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G043200.1
Common NamePHAVU_007G043200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 810aa    MW: 92946.2 Da    PI: 7.3381
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G043200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1881.3e-2749135291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++    ++r+ ++++t+Cka+++vk++ dgkw ++++ +eHnHel p
  Phvul.007G043200.1  49 FYQEYAKSMGFTTSIKNSRRSKKTKEFIDAKFACSRYGVTPETDSG---SSRRPSVKKTDCKACMHVKRKADGKWIIHEFIKEHNHELLP 135
                         9***************************************999888...7788889*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-2449135IPR004330FAR1 DNA binding domain
PfamPF105517.1E-29255347IPR018289MULE transposase domain
PROSITE profilePS509669.347535571IPR007527Zinc finger, SWIM-type
PfamPF044341.9E-6545570IPR007527Zinc finger, SWIM-type
SMARTSM005753.4E-8546573IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscript