PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G043200.1
Common NamePHAVU_007G043200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 810aa    MW: 92946.2 Da    PI: 7.3381
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G043200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1881.3e-2749135291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++    ++r+ ++++t+Cka+++vk++ dgkw ++++ +eHnHel p
  Phvul.007G043200.1  49 FYQEYAKSMGFTTSIKNSRRSKKTKEFIDAKFACSRYGVTPETDSG---SSRRPSVKKTDCKACMHVKRKADGKWIIHEFIKEHNHELLP 135
                         9***************************************999888...7788889*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-2449135IPR004330FAR1 DNA binding domain
PfamPF105517.1E-29255347IPR018289MULE transposase domain
PROSITE profilePS509669.347535571IPR007527Zinc finger, SWIM-type
PfamPF044341.9E-6545570IPR007527Zinc finger, SWIM-type
SMARTSM005753.4E-8546573IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MGDALNEVQH RGGVPATSPK RDIALFEGDK DFEPHNGIEF ESHEAAYLFY QEYAKSMGFT  60
TSIKNSRRSK KTKEFIDAKF ACSRYGVTPE TDSGSSRRPS VKKTDCKACM HVKRKADGKW  120
IIHEFIKEHN HELLPALAYH FRIHRNVKLA EKNNIDILHA VSERTRKMYV EMSRQSGGCQ  180
NIGSFLSDIN YQFDRGQYLA LEEGDAQIML EYFKHVQKES PNFFYSIDLN EEQRLRNLFW  240
IDAKSINDYL SFNDVVSFDT TYIKSNDKLP FAPFVGVNHH SQPILLGCAL VADETKPTFV  300
WLMKTWLRAM GGKAPKVIIT DQDKALKAAI EEVFPNVRHC FSLCHILERI PENLSFVIKQ  360
HNNFLPKFNK CIFKSWTDEQ FDMRWWKMVS ICELQDDIWF QSLYEDRKKW VPTYMGDAFL  420
AGMSTPQRSE STSSFFDKYI HKKITLKEFV KQYGTILQNR YDEEAIADFE SLHKQPALKS  480
PSPWEKQMST VYTHAIFKKF QVEVLGVAGC QSRIEDGDGT VAKFIVQDYE KDEEFLVTWN  540
EMSSEVSCFC RLFEYKGFLC RHALSVLQRC GCSSVPSHYI LKRWTKDAKI KESMADRTRR  600
IQTRVQRYND LCKRAIDLSE EGSLSEENYS VVFRALVDAL KNCVLVNNSN NSGAETSNNA  660
YGFREAEENQ VPLALKPNKK RNAARKRKAQ LEQDVILVNA QDSLQQMDNL SSDAMTLNGY  720
YGTQQNVQGL QVQLNLMEPP HDGYYVNQQG MQGLGPLNSM APSHDGFFGT QQSIHGLGGQ  780
LEFRPATTFG YSLQDEPDPQ FHGNSSRNT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143097.10.0hypothetical protein PHAVU_007G043200g
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLV7BF450.0V7BF45_PHAVU; Uncharacterized protein
STRINGGLYMA10G40510.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein